CDS

Accession Number TCMCG006C12164
gbkey CDS
Protein Id XP_022564476.1
Location join(28313205..28313236,28313577..28313673,28313746..28313840,28314010..28314086,28314194..28314267)
Gene LOC106412487
GeneID 106412487
Organism Brassica napus

Protein

Length 124aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA293435
db_source XM_022708755.1
Definition transcription and mRNA export factor SUS1-like [Brassica napus]

EGGNOG-MAPPER Annotation

COG_category K
Description Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates to a subcomplex that specifically deubiquitinates histones. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03019        [VIEW IN KEGG]
ko03021        [VIEW IN KEGG]
ko03036        [VIEW IN KEGG]
KEGG_ko ko:K11368        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000123        [VIEW IN EMBL-EBI]
GO:0000124        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003682        [VIEW IN EMBL-EBI]
GO:0003712        [VIEW IN EMBL-EBI]
GO:0003713        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005654        [VIEW IN EMBL-EBI]
GO:0006325        [VIEW IN EMBL-EBI]
GO:0006355        [VIEW IN EMBL-EBI]
GO:0006357        [VIEW IN EMBL-EBI]
GO:0006403        [VIEW IN EMBL-EBI]
GO:0006405        [VIEW IN EMBL-EBI]
GO:0006406        [VIEW IN EMBL-EBI]
GO:0006464        [VIEW IN EMBL-EBI]
GO:0006508        [VIEW IN EMBL-EBI]
GO:0006611        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006886        [VIEW IN EMBL-EBI]
GO:0006913        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008104        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009889        [VIEW IN EMBL-EBI]
GO:0009891        [VIEW IN EMBL-EBI]
GO:0009893        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0010468        [VIEW IN EMBL-EBI]
GO:0010556        [VIEW IN EMBL-EBI]
GO:0010557        [VIEW IN EMBL-EBI]
GO:0010604        [VIEW IN EMBL-EBI]
GO:0015031        [VIEW IN EMBL-EBI]
GO:0015833        [VIEW IN EMBL-EBI]
GO:0015931        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016569        [VIEW IN EMBL-EBI]
GO:0016570        [VIEW IN EMBL-EBI]
GO:0016578        [VIEW IN EMBL-EBI]
GO:0016579        [VIEW IN EMBL-EBI]
GO:0016973        [VIEW IN EMBL-EBI]
GO:0019219        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0031248        [VIEW IN EMBL-EBI]
GO:0031323        [VIEW IN EMBL-EBI]
GO:0031325        [VIEW IN EMBL-EBI]
GO:0031326        [VIEW IN EMBL-EBI]
GO:0031328        [VIEW IN EMBL-EBI]
GO:0031503        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033036        [VIEW IN EMBL-EBI]
GO:0034613        [VIEW IN EMBL-EBI]
GO:0036211        [VIEW IN EMBL-EBI]
GO:0042886        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044451        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0045184        [VIEW IN EMBL-EBI]
GO:0045935        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048518        [VIEW IN EMBL-EBI]
GO:0048522        [VIEW IN EMBL-EBI]
GO:0050657        [VIEW IN EMBL-EBI]
GO:0050658        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051028        [VIEW IN EMBL-EBI]
GO:0051168        [VIEW IN EMBL-EBI]
GO:0051169        [VIEW IN EMBL-EBI]
GO:0051171        [VIEW IN EMBL-EBI]
GO:0051173        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051236        [VIEW IN EMBL-EBI]
GO:0051252        [VIEW IN EMBL-EBI]
GO:0051254        [VIEW IN EMBL-EBI]
GO:0051276        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0070461        [VIEW IN EMBL-EBI]
GO:0070646        [VIEW IN EMBL-EBI]
GO:0070647        [VIEW IN EMBL-EBI]
GO:0070727        [VIEW IN EMBL-EBI]
GO:0071166        [VIEW IN EMBL-EBI]
GO:0071426        [VIEW IN EMBL-EBI]
GO:0071427        [VIEW IN EMBL-EBI]
GO:0071702        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071705        [VIEW IN EMBL-EBI]
GO:0071819        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0080090        [VIEW IN EMBL-EBI]
GO:0140110        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1902493        [VIEW IN EMBL-EBI]
GO:1902494        [VIEW IN EMBL-EBI]
GO:1902680        [VIEW IN EMBL-EBI]
GO:1903506        [VIEW IN EMBL-EBI]
GO:1903508        [VIEW IN EMBL-EBI]
GO:1905368        [VIEW IN EMBL-EBI]
GO:1990234        [VIEW IN EMBL-EBI]
GO:2000112        [VIEW IN EMBL-EBI]
GO:2001141        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGAGAGAGAGAGCTGAGAAGAAGCGACGGAGGTACTCGGTGAATCGGTCTCCGGTACCTGATGAAGACGTGACGGATGCTTCATCCGAGAAGGACAAGCTCACGCTTGGAGAAATCATCAACATCAAGTTGGTGGAGAGTGGAGAGAGAGAGAATCTGATGGAGCTTGTGAGAGATAGATTGGTGGAGTCTGGTTGGAAAGATGAGATGAGGGTTGCTTGCAGGGAGCATGTAAAGAAGAAAGGGAGGAAAGATGTCACAGTCGATGAACTAATCCGAGTGATCACTCCCAAAGGCAGAGCTTCAGTACCAGATGCTGTGAAGCAAGAGCTGCTGAACAGAATTCAAAACTTCATTGGATCATCTGCTCCTTGA
Protein:  
MRERAEKKRRRYSVNRSPVPDEDVTDASSEKDKLTLGEIINIKLVESGERENLMELVRDRLVESGWKDEMRVACREHVKKKGRKDVTVDELIRVITPKGRASVPDAVKQELLNRIQNFIGSSAP